SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8FZ42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8FZ42
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.72e-43
Family SMI1/KNR4-like 0.00000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8FZ42
Sequence length 133
Comment (tr|A8FZ42|A8FZ42_SHESH) Uncharacterized protein {ECO:0000313|EMBL:ABV38115.1} KW=Complete proteome; Reference proteome OX=425104 OS=Shewanella sediminis (strain HAW-EB3). GN=Ssed_3511 OC=Shewanellaceae; Shewanella.
Sequence
MHDIIEQLQELSETVPIPLELPTFEQIVVVEEEILMPLPSELKEYLLYASDVIYGTIEPV
TASDPYSHTYLSEVTAYAWSIGMSREYVAICQQGNSFYCIDQEGQVMLWSEDGLESETWE
SFWQWAEEVWMQS
Download sequence
Identical sequences A8FZ42
425104.Ssed_3511 gi|157376643|ref|YP_001475243.1| WP_012143845.1.70442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]