SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8GLV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8GLV6
Domain Number 1 Region: 124-296
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.94e-34
Family DsbA-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8GLV6
Sequence length 312
Comment (tr|A8GLV6|A8GLV6_RICAH) Protein-disulfide isomerase {ECO:0000313|EMBL:ABV74381.1} KW=Complete proteome OX=293614 OS=Rickettsia akari (strain Hartford). GN=A1C_00240 OC=Rickettsiaceae; Rickettsieae; Rickettsia; spotted fever group.
Sequence
MPIFLLFLSSCSEEKTQHKHQEEKQMIEQENLQNNDTSQEMNQGAVNSENAAESIVPAND
NNQTDEVSTPASQAQKNPEIKPVKVTFEVDVNDMVLGNKKSNVIDEVSTPASQAQKNPEI
KPVKVTFEVDVNDMVLGNKKSNVIVVEYFSPTCPHCAYYHQTIFPELKKKYIDTNKIAYV
VREFIATKQDLDAAILARCKGDINSFVQFHNIILQQQDKWAYSNKYRELLTDIGQLGGVP
PEEYKQCLNSDKITETLIANTNFVAKAPKFIGTPSFFVNGVQTGNYSIDSISTAVDKALE
EQKEKAKNEMSL
Download sequence
Identical sequences A8GLV6
293614.A1C_00240 gi|157825169|ref|YP_001492889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]