SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8JNN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8JNN2
Domain Number 1 Region: 577-861
Classification Level Classification E-value
Superfamily ARM repeat 9.7e-24
Family Armadillo repeat 0.0098
Further Details:      
 
Domain Number 2 Region: 856-933
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.45e-16
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 
Domain Number 3 Region: 1005-1148
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000000000000641
Family Toll/Interleukin receptor TIR domain 0.007
Further Details:      
 
Domain Number 4 Region: 937-999
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000222
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8JNN2
Sequence length 1562
Comment (tr|A8JNN2|A8JNN2_DROME) Ectoderm-expressed 4, isoform G {ECO:0000313|EMBL:ABW08491.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG43119 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MVVTSTRSPLLAQTQPANASTSGTHTSAALRSRLIFPRQHYQMTDFSDSSPSGVLSPPTS
LIENFHKKNSSPQPLGSSSAISTLTPTTLNGSVVGGGVGGAGHHSIENGRQINTSSSSCS
SLKETSHQSTSTSQQVVNSSSSTTTRVEKKSQRLHHHITSSSSSSSTTQALSTSSEMKAA
EIKRDLTNIQKSMSEINDLAKERITGGPGSISTTSASAITAPSTMSQTTTSRLAPKLTSA
HPSIDDLRGLSRQDKITQLQKKIRASFENLVDHDDSNVIVTLPDDDDCPHNHFGSGLNLT
HPTAAQLSASGLSGSSKTIDTIKFQEKSMKTESKTKVVTDGFSSEQATSNSAEMKRLQAG
DIDYQESKGASAMRNRLEVDGVKTEENAAVIKEALSLRTGDITQQASNNVAASSITVQSE
NFSADKKAISQSQQSQTMTSNGIISQEKHVSSASQANYSMSHKGVSSTGSSMITSSSQMS
AMNGQMLKLADLKLDDLKSLTAGSGQQEIEQTINKYSNMLTSIVSSLQEDERGGSAITVH
DVGGKKSQYLEKINEVIRRAWAVPTHGHELGYSLCNSLRQSGGLDLLMKNCVKPDLQFSS
AQLLEQCLTTENRKHVVDNGLDKVVNVACVCTKNSNMEHSRVGTGILEHLFKHSEGTCSD
VIRLGGLDAVLFECRTSDLETLRHCASALANLSLYGGAENQEEMILRKVPMWLFPLAFHN
DDNIKYYACLAIAVLVANKEIEAEVLKSGCLDLVEPFVTSHDPSAFARSNLAHAHGQSKH
WLKRLVPVLSSNREEARNLAAFHFCMEAGIKREQGNTDIFREINAIEALKNVASCPNAIA
SKFAAQALRLIGETVPHKLSQQVPLWSVEDVQEWVKQIGFNDYIDKFNESQVDGDLLLKL
NQDNLRADIGIGNGILLKRFERELQNLKRMADYSSKDTAKMHQFLSEIGTDYCTYTYAML
NAGIDKCALPHVNEDMLMTECGIHNSIHRLRILNAVKNLENSLPSSSEENMAKTLDVFVS
YRRSNGSQLASLLKVHLQLRGFSVFIDVERLEAGKFDNGLLNSIRQAKNFVLVLTPDALH
RCINDEDCKDWVHREIVAALNSNCNIIPIIDQQFDWPEVERLPEDMRSVAHFNGVNWIHD
YQDACIDKLERFLRGEKNIDRIAAMVPGTPGSVSYQRMHSNDSDYQSGGAGAGSGAGTGG
GGGGGVTGSVVDGLMVAANGSGQANHQANRYRQSPSPARQRGSTSQLSGYSRAPSKRSQI
LTPYRTQQAALLHKTGAGSASMQNMMPLAYLPPRRSSAAGLGHGSGSGMGSGYRSHSVDG
LLDQAGSTPEQRIAAAAAKVTAGSTALTNASSTSTLQPEEEVTDAALNDSVTRRDKHTLS
PPGNVQQHRKSRSLDHILSKQTLAELLPPSSELADGTQSMQNLAIPMTPQPQRRDTSSSS
KSPTPERPPQPAMERVRERQSPEGVSATESEREDQPEECLRHGNQQRASASVHRGASLTS
NKTSNSSLGSNFSAGGNNKTIFNRTMKKVRSLIKNNEMEDEELSGIILSKATSPNAGRMI
FW
Download sequence
Identical sequences A8JNN2
FBpp0293533 NP_001097544.1.81976 FBpp0111513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]