SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8JQ65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8JQ65
Domain Number 1 Region: 79-205
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-27
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 
Domain Number 2 Region: 352-480
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.89e-24
Family Diacylglycerol kinase-like 0.016
Further Details:      
 
Domain Number 3 Region: 1433-1615
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.09e-22
Family NAD kinase-like 0.073
Further Details:      
 
Domain Number 4 Region: 1829-1892
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.57e-18
Family SAM (sterile alpha motif) domain 0.0071
Further Details:      
 
Domain Number 5 Region: 251-322
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.88e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000608
Further Details:      
 
Domain Number 6 Region: 185-248
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000688
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8JQ65
Sequence length 1895
Comment (sp|A8JQ65|DGKH_DROME) Diacylglycerol kinase eta {ECO:0000250|UniProtKB:Q86XP1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG34384; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAHLKLDTLHVQRSPRGSRRSSPSSGRSSACSSGSISPVPIIPIISISHDGDESESESEI
ETEPARLFQRRMSTKCTNNLAAIIKEGFLLKHTWSFQRWRRRYFRLKRNMLFYAKDEKCD
VFDDIDLSDLCYFECGIKNVNHSFQIITPTRSLVLCAESRREMEDWLGSLKTATAPQRPR
GDSFLIEQHDILSNHHHWYATSHARPTYCNVCRDALSGVTSHGLSCEVCKCKVHKRCAAK
SIANCKWTTLASVGKDIIEQADGIIMPHQWMEGNLPVSSMCAVCKKTCGSVLRLQDWRCL
WCRATVHVACRPQMAVACPIGPAKLSVVPPTSVHSISTDDAWDVASPKGNFSPLLVFVNS
KSGDNQGVKFLRRFKQLLNPAQVFDLISTGPSLGLRLFRHFEMFRILVCSGDGSVGWVLS
EIDRFNMHKQCQVAVMPLGTGNDLARVLGWGSSCDDDTHLPQILERYESASTKMLDRWSI
MVFEKAIPVPKTPKMSISTEQEAMLTGMVTSANHHLRFIVETNDTQTLIRSTRNLCDTVD
DLVCRISEHHKDDEQLAVKCDILRQKLNMLLDALQEEEIGAHSGDDLIATIRSLIARSIP
VTPGSNAYLLNPNISIEKTEKDQINTKERRNSRSLRSSEKEALQCRANSVKRAIYNVVEH
SEPGRPKRYQRKLSITPFEALKLPTASGESTPCTSPLPIIPPINIISPTMETSRLTCISP
LPDTRRDSVDENFFNSINLPAPRQFADSRRSSGVEVIQEIEEGANGETVYRKSRMSLTGG
ANIDDAGNRLSPCSDAGENTPTERKVDFLRVPIHTGEPIVDPLCDYRPHEVFERTYYMTR
EMDKGKEKDKEKDKPVEIDKEKDTCVEKEGSMPAEKLVHTCNLQVPGVVVTPNPQNVYSS
ASITIIDTDAQTTTEQSSSDDLGGEASDVLSAISNEECSVASEIFDKQDAGQTVGDIIQN
MDASNFTHIDSPETSDETEAMPGESIMDDISSVLGHDITYALQDNTLTDDTTTLCSEHAG
PPKPPRKKSLSALSRTQAHPRRRNSSPPRMARLARMDSDDNPQQFGFENIVFEIDNRCDD
QKMREPPRYCSLAQFVEGNDIARQSFKQLMLEQHRGGDNDSDYPEHEQTPTNKGANLLAT
TSEDELSTQTAIKIEIQDIDATVRNLNSSMKPNTILTTSTSPTKKSGHGQDVKRITFDES
CKKESFDDVNPNYPQISVVVRPPTPLRGDCIKPTVSLLPVSSGGAMTVSMTCSGMLGVRA
MNASEIRRHSSHAPGLAVREFDKDKDRRHSGFNPNQLTLDPEHARFLSSSPAASRRISCG
SLFKPNEALPNLQTLKGSKSSLFMGSTLFGFDHLASAEKDKEEKSGKDKEKTPTDETNRK
LPIINPLVRLPNWPNLANGGGFISKCLLANADTLCAAVSPLMDPDETLLAGYHEKCVMNN
YFGIGIDAKISLDFHNKREEHPEKCRSRARNYMWYGVLGSKQLLQKTCKNLEQRVQLECD
GQRIPLPELQGIVILNIPSFMGGTNFWGSSKKDDIFLPPSFDDRVLEVVAVFGSVQMAAS
RLINLQHHRIAQCQSVQINILGDEEIPIQVDGEAWLQPPGMIRILHKNRVQMLCRNRSLE
LSLKSWQEKQRQHSISIQRDASSTASEHANSTDEVISERECYVLLNFIEAVSSLVKWVKF
LIISHPALQHDLYEVACRASEALESIHPQGKLLEGPSLRTKLVEVIDSSRQLYDDACTLL
RDRGHSLILREDLETKLSAALANMEMELKKCSVQKCIDGKLRAYFNVLAPNEESDGRRKS
RPFWVRLRSGSTAGQQAFKPPLTNTREAANNWSVNEVVTWLETMQLSEYVDSFLKNDIRG
KELLTLGRRDLKDLGVVKVGHVKRILQAIKDLSEN
Download sequence
Identical sequences A8JQ65
FBpp0111537 FBpp0111537 7227.FBpp0111537 NP_001097704.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]