SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8JQZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8JQZ8
Domain Number 1 Region: 30-313
Classification Level Classification E-value
Superfamily L domain-like 6.8e-59
Family Ngr ectodomain-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8JQZ8
Sequence length 474
Comment (tr|A8JQZ8|A8JQZ8_DROME) Flyers-cup, isoform D {ECO:0000313|EMBL:ABW08663.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG9611 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPKRLYDINEADADSKAVNLEQLTIKEEDAWWNQVPLNNLDLSSNTLTHISPKIENLQSL
TVLTLHDNALVELPPEIGKLEKLVRLNVSHNKLSQLPRAMYSLPELRHLNISYNEFVELN
PDISDLHMLEFLDGGHNNIQSLPGGIGFLVRLTALLLPYNHIKELPPDLVNMRSLQKIDL
MHNDLTSLPEDMGLLRKLDCLYLQHNDILELPEFEGNEALNELHASNNFIKIIPKAMCSN
LPHLKILDLRDNKITELPDELCLLRNLNRLDVSNNTISVLPVTLSSLAHLISLQVEGNPI
KTIRRDILQCGTTRILKTLHDRAVAKAKEEGGGVDDASTSAGISVTRLRGGQMDDGDIPG
NFPDSFHHQQQQNGFQCPCSYPCQQQQMQQQFCVYEPLRNCQEYDRQTQGRIYEPENYQQ
QHQNGSLRSLFVQQQQQRMEYPYPGYFMYQQQQQQQFSYEQDPSSRSAVHPRWV
Download sequence
Identical sequences A8JQZ8
FBpp0111851 NP_001097773.1.81976 FBpp0111851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]