SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8JUY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8JUY0
Domain Number 1 Region: 716-807
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-23
Family Canonical RBD 0.0097
Further Details:      
 
Domain Number 2 Region: 200-617
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000114
Family HAT/Suf repeat 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8JUY0
Sequence length 941
Comment (tr|A8JUY0|A8JUY0_DROME) RNA-binding protein 4F, isoform F {ECO:0000313|EMBL:ABW09339.3} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG3312 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MDADKQLERQLEKELDEMPAEDLDDDAYDEYDLIVIPDQGKGSPQQGHSESPQQEEEHKS
EELRQRSRPTWPPSSAGGDMTTIELISSDDEPSVEETEGGNAAGRGRARNDSSSSSDDVG
VIEGSELESNSEVSSDSDSDSDNAGGGNQLERSYQELNALPSKKFAQMVSLIGIAFKLND
LEKIESSVLELQNLATVPAHVWLKYLKARLVVTQTDEERKAFEEQCAKALGYYYSIPLSE
YVVNYLVDQGNVQNHVLWAKLLADYDVERPDFGDKLRSLISTITDENEAAAFVEMLQKHC
VTWTCNVEQRQMIKSVVDKFKQHLDETTRGWDWSEQHKAHVYDVETLSLDDDLKNAVIRF
IFERSVAKFPIVDVLWLSYIEFIQFEGVTVPENEDENEVTAEMVAKRAKRLGKGFLRNTE
LDLANRGVRSHPSVQLNHRFLDLMERSDFELAEVDEEIRLILQRIVTDMDMTVELHLDYL
AYRIRNTNASDEQQVASLRAAFNHAWEELTVLYGDQADTRYEVLQLWAQVEYTQLGSPDN
GREIWRQIMGYPGSSIRGLLWLNFAQMESEYNGGHGTRDVLRKALSQPVLENGLMVQEFF
RRYERCYGTYESIAACQALDLPVEYVKPRSRIKPNSQSAYPRQQKLKPRQQQQQTNREPL
NREQRRRQAHEQQQQQQQQQKHGIKKSRTEPSGGATSPPSKVKGPANAEAKESNFKYSPN
MEINKIFVRNLHPACSKEELHELFSPFGTIKDVRLVHKLNKQFKGIAYVEFEKPGEAQRA
VAGRDGCLFKGMNISVAISNPPPRGTSAVKPSVAPKRRVPTSLIPTTLVRQEVAAKKLRL
LLPEPGDISSTSASVDVAIKREANGEEQKGDVQERDEQKGEEQKGEEQKGEEPKGEEQKG
DDQIGEEQSGVEQKGDEKKEEEMPAAVPKSNDDFRKLFLKD
Download sequence
Identical sequences A8JUY0 Q9W4D2
NP_001096883.3.81976 NP_001096884.1.81976 NP_511047.2.81976 NP_996353.1.81976 7227.FBpp0111789 FBpp0070720 FBpp0089396 FBpp0111789 FBpp0070720 FBpp0089396 FBpp0111789 FBpp0070720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]