SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8L3R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A8L3R8
Domain Number - Region: 52-104
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0034
Family Cgl1923-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8L3R8
Sequence length 256
Comment (tr|A8L3R8|A8L3R8_FRASN) Uncharacterized protein {ECO:0000313|EMBL:ABW16328.1} KW=Complete proteome; Reference proteome OX=298653 OS=Frankia sp. (strain EAN1pec). GN=Franean1_6997 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MHEDSSRPLPTGPDPTAGGPVGDDAGAGTRTPPADATSWWNGDPTVPAAPGEDTPPAAAV
LVSVVERLAAIEATLTDFHRRADHREAVIDRLHEERLEQRSGVRRALLDPIVTDLIRLYD
GLSAESERMSGGGDSRTSNLLASFADDVELALERCGFDLVRPRPGDRFQSGAQLAASVVP
TDDPARHNTVAEVTQVGVLERDTGRVRRPARTRVFRSRRPGSEGSDATEASPATAAPPAP
PAPSAPAPPSPAQSGL
Download sequence
Identical sequences A8L3R8
gi|158318726|ref|YP_001511234.1| 298653.Franean1_6997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]