SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8M6E3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8M6E3
Domain Number 1 Region: 1-378
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 6.04e-59
Family Gtf glycosyltransferase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8M6E3
Sequence length 387
Comment (tr|A8M6E3|A8M6E3_SALAI) Uncharacterized protein {ECO:0000313|EMBL:ABV97168.1} KW=Complete proteome OX=391037 OS=Salinispora arenicola (strain CNS-205). GN=Sare_1263 OC=Salinispora.
Sequence
MRVLVLAGIAPSTVFSHVPLAMALRNSGHQVMVTASLDDMIPTIAGVGLPAIRTTDPDLG
PREIFARDSRLLEIPEDPVAREQQSGHWYGRLEAVTLDALVAFAEDWPPDVIIGGMGSYA
APLLAKRLGVPHVRHGWDIHDPHLVDLGATEELQPELAELGLSEIPEPDMTIDITPPSLR
LPDAAPAQTMRWIPGNTQCLLEPWMYKRGADTRIGVTIGTGVARYNQYDFLQAIVENISI
PDAEVVVPITEDSLPGLRDRLKNVLAGWIPLDIVAPTCDVLVHQSGGSTMMTALSFGVPQ
VLIPDPALHRANEMARRIVEAGAGIMLTPEEATSDVLAKSCQEIVSNPKHAAAARSLARE
IAALPLPSEVARRIEWLVHTEPARRRD
Download sequence
Identical sequences A8M6E3
391037.Sare_1263 gi|159036906|ref|YP_001536159.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]