SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8MRC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8MRC0
Domain Number 1 Region: 122-180
Classification Level Classification E-value
Superfamily DNA-binding domain 2.29e-22
Family GCC-box binding domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8MRC0
Sequence length 356
Comment (tr|A8MRC0|A8MRC0_ARATH) Related to AP2 12 {ECO:0000313|EMBL:AEE33024.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=T18A20.14 OC=Arabidopsis.
Sequence
MCGGAIISDFIPPPRSRRVTSEFIWPDLKKNLKGSKKSSKNRSNFFDFDAEFEADFQGFK
DDSSIDCDDDFDVGDVFADVKPFVFTSTPKPAVSAAAEVFGKKVTGLDGDAEKSANRKRK
NQYRGIRQRPWGKWAAEIRDPREGARIWLGTFKTAEEAARAYDAAARRIRGSKAKVNFPE
ENMKANSQKRSVKANLQKPVAKPNPNPSPALVQNSNISFENMCFMEEKHQVSNNNNNQFG
MTNSVDAGCNGYQYFSSDQGSNSFDCSEFGWSDQAPITPDISSAVINNNNSALFFEEANP
AKKLKSMDFETPYNNTEWDASLDFLNEDAVTTQDNGANPMDLWSIDEIHSMIGGVF
Download sequence
Identical sequences A8MRC0
NP_001077718.1.80155 AT1G53910.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]