SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8NB00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8NB00
Domain Number 1 Region: 860-1177
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.74e-16
Family 2,6-dihydropseudooxynicotine hydrolase-like 0.01
Further Details:      
 
Domain Number 2 Region: 483-691,725-784
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000000000221
Family 2,6-dihydropseudooxynicotine hydrolase-like 0.022
Further Details:      
 
Domain Number 3 Region: 3096-3416
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000000183
Family 2,6-dihydropseudooxynicotine hydrolase-like 0.04
Further Details:      
 
Domain Number 4 Region: 91-280,333-403
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000000244
Family 2,6-dihydropseudooxynicotine hydrolase-like 0.013
Further Details:      
 
Domain Number 5 Region: 2411-2715
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000000000775
Family 2,6-dihydropseudooxynicotine hydrolase-like 0.027
Further Details:      
 
Domain Number 6 Region: 2017-2325
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000000181
Family 2,6-dihydropseudooxynicotine hydrolase-like 0.031
Further Details:      
 
Domain Number 7 Region: 1627-1844,1890-1935
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000000499
Family 2,6-dihydropseudooxynicotine hydrolase-like 0.022
Further Details:      
 
Domain Number 8 Region: 1292-1549
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000000352
Family 2,6-dihydropseudooxynicotine hydrolase-like 0.044
Further Details:      
 
Weak hits

Sequence:  A8NB00
Domain Number - Region: 2798-2945
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000737
Family 2,6-dihydropseudooxynicotine hydrolase-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8NB00
Sequence length 3438
Comment (tr|A8NB00|A8NB00_COPC7) Cip2 {ECO:0000313|EMBL:EAU89778.2} KW=Complete proteome; Reference proteome OX=240176 OS=9003) (Inky cap fungus) (Hormographiella aspergillata). GN=CC1G_09360 OC=Coprinopsis.
Sequence
MDALKRPLVALALALPVLASIGSWTVGGAHDWYGDSYTKNIPSHLAPLDVSSGSDSLVRR
QQPPNCAPPANPTLAPVERLNNPFVFLDGRPVADDADWYCRRQEIATLFQRYELGTLPPN
PASVSASLSGTTLTINVASSNATTSFEASIEYPQGGGDGPFPAIIALGGSSLPTPAGVAV
ISFNNREIAFDSGPIGRGQGKFYHLYGAYHPAGALMAWTWAVSRIIDGLALTPGARIDVG
KLAVTGCSVAGKGALVAGAFEPRIALTIPVESGTGGAGCWRIADDIREGGGAIVTASELA
NTTTYYSTSFNAFATNIPTLPIDHHLLQALVAPRGLLILDNSQYSWLGPASVFGCSKTAN
GVYRALGIGDRLGVSIVGGHDHCVFPGQQYPEFQAYINKFLRGIDGENTNVLKSDVPNNG
GFDEAKFVNWTIPQLVAPPPPPPPPEPGVCDAPLDLDLTTPIPRLNNPFVFLNGSDVSDT
NDWYCRRQEISSLFQRWELGYLPPRPSSVTGTLSGNTLTISVTNEGRTISFTASITYPEG
NGPFPAIIAVGGSTIPAPAQVAIITFNNRELAVDDGTRGQGKFYDLYGNNHSAGVLMAWA
WGVSRVIDAISSVPNSRIDPGKLGVTGCSNNGKAALIAGAFEQRLALTIPVETGTGGAGC
WRLADDLRENGVGLVTARDLVSTTSYYATAFTPFAENIPTLPFDHHLLASLVAPRGLLVL
DNSQYPWLGPPSVYGCMVTANKVYQALGIRDRLGVSIVGGHDHCVFPGQQYPELQAFVNK
FLRGSQNENTNFIKTDVPNNGGFDEDEWVDWEVPNLIPVVEPPPPPPPGVCDAPLELDLT
ANPTLNNPFVFVNGSKTVENTGDWYCRRQEIGSLVQRFELGYQPENATTTGSLSGNVLTV
NVSHEGRSITFAATITYPTGNGPFAALIGIGGSTVPQAPEIATITFNNQEIAVDNGVQGR
GQGKFYDLYGSNHSAGALLAWAWAVSRVIDALAATPNVRIDVGKLGVTGCSASGKAALVA
GAFDPRLSLTIPVESGIGGAGCWRIADDIRAGGGAIVTAGELANTTSYFTPAFAALANNI
PTLPFDHHLLAAMVAPRGLLVLDNSQYSWLGPPAVYGCMVTANKVYQALGIRDRLGVSIV
GGHDHCVFPGQQYPEFQAFINKFLRGAVNENTNYIKTDVPNNGGFDEAKWVNWQVPNLVP
VVEPPPPPPPQVCDAPAELDLTPVSRLNNPFAFVNGSKTVETSDDWFCRRQEISNLFQRL
ELGFIPGRPTTVSGSLSGNTLTINVGHEGRSISFTATITYPQGNGPFAAIIGIGGSTLPP
PPEVAVINFNNQEIAVDSGTTRAQGKFYDLYGANRSAGSLAAWAWAVSRIVDAVSSTPNI
RIDAGKLAVTGCSAAGKAALVAGAFEQRIALTLPVESGIGGAGCWRIADDLRNGGAAIVT
AGELANTTAYFSRDFNPFAANIPTLPFDHHLLAALVAPRGLLVLDNSQYSWLGPQSVYGC
MVTANKVFQALGIRDRLGVSIVGGHDHCVFPGQQYPEYQAFVNKFLRGITSENTNVIKTD
QPNNGGWDEAKWVDWTVPNLAPGQPPVEPPPPPPPQVCDAPAELNLSAVDRLNNPFAFVN
GSKNVEDVNDWYCRRQEIGSLFQRLELGYVPARPSTVTGSISGNALTVTVGHEGRTTSFT
ANITYPQGNGPFAAIIGIGGSSVPAPPEVAIITFNNQEIAVDNGVAGRGQGKFYDLYGTG
HTAGTLVAWSWAVSRIIDALQSTQNSRIDAGKLAVTGCSAAGKAALVAGAFEQRLSLTIP
VESGIGGAGCWRVAEELRRGGAAIVTAGELANTTSYYSRDFNPFAANINTLPFDHHLLAA
MVAPRGLLVLDNSQFSWLGPQAVYGCMVTANKVYQALGIRDRLGVSIVGGHDHCVFPGQQ
YPEFQAFINKFLRGITSENTNVIKTDQPNNGGWNESRWVDWTVPTLVPGQPPTEPPVEPP
PPPPPQVCDAPAELNLSAVDRLNNPFAFVNGSKNVEDVNDWYCRRQEIGNLFQRLELGYV
PAQPSTVTGSLSGNSLTVTVGHEGRTTSFTANITYPQGNGPFAAIIGIGGSTVPNPPEVA
VITFNNQEIAVDNGVAGRGQGKFYDLYGTGHTAGSLVAWSWAVSRIIDALQSTQNTRIDV
GKLAVTGCSAAGKAALVAGAFEQRLSLTIPVESGIGGAGCWRVAEELRRGGAAIVTAGEL
ANTTSYYSRDFNPFAANINTLPFDHHLLAAMVAPRGLLVLDNSQYSWLGPQSVYGCMVTA
NKVYQALGIRDRLGVSIVGGHDHCVFPGQQYPEFQAFINKFLRGITSENTNVIKTDQPNN
GGWNESRWVDWTVPTLVPGQPPTEPPVEPPAPPPPQTCDAPAELNLTAVDRLNNPFAFIN
GSKTVTTADDWYCRRQEISNLFQRLELGYVPPRPATVTGSLSGNSLTINVGHEGRSTSFT
ANITYPQGNGPFAAIIGIGGSTVPAPPEVAIITFNNQEIAVDNGVAGRGQGKFYDLYGTG
HTAGNLVAWSWAVSRIIDALQSTQNTRIDVGKIAVTGCSAAGKAALVAGAFEQRISLTIP
VESGIGGAGCWRVAEELRRGGAAIVTAGELANSTSYYSRDFNPFANNVNTLPFDHHLLAA
MVAPRGLLVLDNSQYSWLGPQSVYGCMVTANKVYQALGIRDRLGVSIVGGHDHCVFPGQQ
YPEFQAFINKFLRGITSENTNVIKTDQPNNGGWDESRWVNWQVPNLAPGQPPVDPPTPPT
PGSCSAPQNITLTPNTRLNNPFSFVNGSKSVTTTDDWFCRRQELTDLFQRYQLGTLPGRP
STVTGSLSGNTLTVSVSNGGQSTSFTASINYPTGDGPFPAFIAIGGSTLPQPAAVAVITF
NNQEIAVDNGAASRGQGKFYDVYGSNHPAGALVAWSWAVSRIIDALGAVQNSRIDLGKLG
VTGCSAKWQGRSRRCQYSWLGPQAVYGSAVSASRVYRSLGIADRLGVSIVGGHDHCVFPG
QQYPEYQAFVNKFLRGSLTENTNFIKTDVPNNGGFDEGRWIDWTLPTLAPGQPPTEPPTQ
PPTNPNVCAAPQNLTLTANTRLTSPFTFAGSTRAVTSTNDWFCRRQELTDLFQRYELGTI
PSPPSSVTGSISNTTLTVNVSHNGRSTSFVASITYPTVGEAPFPAIIGIGGSALPTLPGI
AVITFNAQEIAVDNGAAARGQGKFYDLYGSDHSAGVLAAWSWAVSRVIDAAGSTQNSRID
ASKIAVTGCSGSGKAALVAGAFDQRISLTIPQESGTGGAGCWRIADELLRNGQGIVTAAE
LVNSTAYFARDFNPFASQVNNLPFDHHLLAALVAPRGLLVLDNTQYSWLGPQSVYGCMRT
ANKIYESLGIADRMGVSLVGGHDHCVFPGQQYPELNAFVNKFLRGSLNENTNVIKTDAPN
NGGFDESRWVDWTTPRLS
Download sequence
Identical sequences A8NB00
XP_001832002.2.59657 CC1G_09360T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]