SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8NGN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8NGN3
Domain Number 1 Region: 38-164
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000164
Family Fibronectin type III 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8NGN3
Sequence length 172
Comment (tr|A8NGN3|A8NGN3_BRUMA) Lethal protein 805, isoform d, putative {ECO:0000313|EMBL:EDP39255.1} OX=6279 OS=Brugia malayi (Filarial nematode worm). GN=Bm1_02140 OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MSAYAASLQKLIVALILIYAIRGNEPRIRLRREIGGSQSLLTVEWEGIQTGDHPDDSVGG
FAVEYRAEKDTQWHVHDGIIPYKGPNLQYRVQIPRLPTGIAYFVRIKVLGKNGKILVETP
EIRARNEMVSIKCESDELTAPRNLEVTQTGQYSIAIAWEPPECGSVGEYHIE
Download sequence
Identical sequences A8NGN3
XP_001891935.1.25112 XP_001895360.1.25112 Bm1_02140 Bm1_19525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]