SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8NMY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8NMY1
Domain Number 1 Region: 254-341
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000246
Family Thioltransferase 0.05
Further Details:      
 
Domain Number 2 Region: 458-537
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000413
Family UBX domain 0.084
Further Details:      
 
Weak hits

Sequence:  A8NMY1
Domain Number - Region: 43-90
Classification Level Classification E-value
Superfamily UBA-like 0.00408
Family UBA domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8NMY1
Sequence length 652
Comment (tr|A8NMY1|A8NMY1_COPC7) Uncharacterized protein {ECO:0000313|EMBL:EAU86775.1} KW=Complete proteome; Reference proteome OX=240176 OS=9003) (Inky cap fungus) (Hormographiella aspergillata). GN=CC1G_09900 OC=Coprinopsis.
Sequence
MLPSIEPEPLCREATAKSDCGSKERVGGWRRVWYYGVVEFEMDGLSESQQAAVIQLRELT
NGGDDEVAIGVLRSVNWDVGRAADLVFGGTGVGQAPPAPNSDTERHAFTVDDSEQGFTYD
HQSSSLSTATRPILTILSFPFTLLSSIFRFIFNVLRIPFPSLGRFVGLTFYSPLNRNASR
RGHGSGGPDRWIRELEEETGAICIGRLKASKGVSSGRDNDRGEAGPSGPSSSTLSSRAAA
SGGDGIFEDGRLVLPDFVGGTYEGALKTCQREYRVGCIILVSEEHDDVAEFKRSTLTDQT
FVKTLHDNNVLVWGGDVRDREAWSASEKLQATTYPFVAFVALQPRRTVGNSSSSRSTPPS
LTVLSRHQGPSTPSRNATGPTSAQTLTAHLTTQVLPRVTPYLAGLRSAQLEIERARQLRE
EQDRAFQDSARRDTERIQRLMREEEERKREEQRLLEVKQREEKERKRAEEERIKKEEERM
EWRRWTRKALRDREAITDGKPLRLAIRLPNGTRTVSQFTSRDTLTTLYATVDAQLVPSHL
SPDDDPASPPSPSNPGSSLEETLESLIPSYSASTSTTSTQSYFNFLLASSYPRTELPWSP
STPLSSVPELKGGGQLVVEMVTDSGRSSRASSRANGAGNGGDDSDEYDTEED
Download sequence
Identical sequences A8NMY1
XP_001835009.1.59657 CC1G_09900T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]