SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8QGE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8QGE7
Domain Number 1 Region: 15-82
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000648
Family PHD domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8QGE7
Sequence length 166
Comment (tr|A8QGE7|A8QGE7_BRUMA) PHD-finger family protein {ECO:0000313|EMBL:EDP28668.1} OX=6279 OS=Brugia malayi (Filarial nematode worm). GN=Bm1_55115 OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
FELSDDSDDNTSRKFSGSQNKNCKVCYACSGTTSLPSNTILDCEECGKTVHQKCARPEIT
ALQAKDPRFLFVCNDCKDRDDEKMGSSCSKSVTNFRKDDKGSMRKSSEERIQPLKPENDI
LVTFSNFAAKKAKKSASSGTSGSSNLQVSGVTINKVLPSFSVKDRK
Download sequence
Identical sequences A8QGE7
Bm1_55115 XP_001902481.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]