SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8R4B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8R4B3
Domain Number 1 Region: 43-150
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.8e-27
Family Multidomain sulfurtransferase (rhodanese) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8R4B3
Sequence length 159
Comment (tr|A8R4B3|A8R4B3_BOVIN) Sulfurtransferase {ECO:0000256|RuleBase:RU000507} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TSTD3 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MVLQRLLPWSTCRTIFGSAEAVLWGLKSIKRSCLNFCTAICEGVTYKELKNLLKSKKIML
IDVREPWEIYESGKIPGSVNIPLDDVGEALQMNPKDFKEKYKEVKPSKSDSLVFSCLAGV
RSKVAMVTAISLGFNNAQHYAGGWKEWATYEISEKKQGN
Download sequence
Identical sequences A8R4B3
NP_001103564.1.59421 NP_001103564.1.76553 XP_019822874.1.53367 9913.ENSBTAP00000047717 ENSBTAP00000047717 ENSBTAP00000047717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]