SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8X056 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8X056
Domain Number 1 Region: 136-167,233-327
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-25
Family Voltage-gated potassium channels 0.005
Further Details:      
 
Domain Number 2 Region: 335-418
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-19
Family Voltage-gated potassium channels 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8X056
Sequence length 557
Comment (tr|A8X056|A8X056_CAEBR) Protein CBR-TWK-35 {ECO:0000313|EMBL:CAP26016.1} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG05561 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MLLSHGESRQSFKQKKAEEKRRRSSSGHGPQAKQSLAVLAQLMLPALIEEHTAQQEDVFV
PAHYRADGSLASTVTNRRHVLQRVNLLQRANCQMRKGAAGVWDIAGRAHLAGKRKVEQLQ
QKPPLWLVILNRAYHKYGLKHAVLILVFLVYCIAGGLIFWLIEEPFQSELRDKWHQKIYN
NRTERVDFMMKRIFNNSDFLIYIKGNTTTRLEQFFKEEFASYENQLGVKWSQQKMDWDFW
NAVLFAGTICTTIGYGHIYPMTDAGRLLTMCFALFGIPLMLLVLQDFGKLLTITMKFPWF
QTKRLMRRIMRCCTKQPIEEMREIERQERHDLDIFDLPLPVGIGLIVVWIFICSFVLSVW
DHNWTLLESFYFFFTSLSTVGLGDLVPSSPRLLITMFGFILVGLSLVSMVINLLQAKMKS
TYEAGRNDDKALTHHAHTLPTSLGVMQCYSADEEKKADVSERSLSRSTQTSLSLPGVRQV
VLRSDGVHWVNTDTSSPTKSPDEVTNLVEMETALRVCEQIGDNNNEEYSEGESLICETEV
LLELGECLSDLERCDSI
Download sequence
Identical sequences A8X056
6238.CBG05561 CBG05561 XP_002638529.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]