SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8X1C7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8X1C7
Domain Number 1 Region: 1-22
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000524
Family LDL receptor-like module 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8X1C7
Sequence length 113
Comment (tr|A8X1C7|A8X1C7_CAEBR) Protein CBG05913 {ECO:0000313|EMBL:CAP26437.2} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG05913 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MCDGKIDCPDHSDEQHHICMKRNSVNKLQTQEINVGLKCPQPWFRCVDSSSCIAPHKKRT
FQRNIHDHTDTYITSRMKERGGVPLSIFTMTAEENHGFCHSFLIFRRSYHSSS
Download sequence
Identical sequences A8X1C7
CBG05913 6238.CBG05913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]