SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8X4X5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8X4X5
Domain Number 1 Region: 13-52,109-171
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.36e-23
Family Voltage-gated potassium channels 0.0051
Further Details:      
 
Domain Number 2 Region: 195-308
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-18
Family Voltage-gated potassium channels 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8X4X5
Sequence length 424
Comment (tr|A8X4X5|A8X4X5_CAEBR) Protein CBR-TWK-23 {ECO:0000313|EMBL:CAP27685.2} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG07369 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MGKKKESMAKCAWMKFRNVLRIALGHLALYCFVVCYVFAGAWVFHQLEGENETELHDKQR
EYAMNLKKDVIAKLATTENVAEINEHLRMFLRNISNLHISLDNYLIFNEPSQVVPKRWTF
PSSVLFSFTILTTIGYGNVTPHTQQCKVFLMIYGAFGIPLFLITIADLGRFSKTAIMALV
QKVSKRELKKQSDEHLLREIAEVMLVAGLFVVFIAIGSAVIPLWENQLTYFDSVYFSYMS
LTTIGLGDIVPRRMDFLLPTLIYITIGLWLTTALVEQLADVFRLVHYAGRQVTNVKGITV
WLGGRRLSMGGLISTVCRRVGMSENLINQINWDRTVIDALDGKMPPTLPIFPWHFTDFLE
HDPPLIDLSIDLDQMDGSFYCSKPLSAKKQRRASQMSAPAIAWMRPQEEARILDADGNFP
NIDA
Download sequence
Identical sequences A8X4X5
CBG07369 6238.CBG07369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]