SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8X5V5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8X5V5
Domain Number 1 Region: 43-167
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 5.49e-49
Family N-terminal domain of cbl (N-cbl) 0.000026
Further Details:      
 
Domain Number 2 Region: 256-341
Classification Level Classification E-value
Superfamily SH2 domain 1.53e-45
Family SH2 domain 0.0000214
Further Details:      
 
Domain Number 3 Region: 168-253
Classification Level Classification E-value
Superfamily EF-hand 4.77e-31
Family EF-hand modules in multidomain proteins 0.00041
Further Details:      
 
Domain Number 4 Region: 349-421
Classification Level Classification E-value
Superfamily RING/U-box 2.94e-24
Family RING finger domain, C3HC4 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8X5V5
Sequence length 546
Comment (tr|A8X5V5|A8X5V5_CAEBR) Protein CBR-SLI-1 {ECO:0000313|EMBL:CAP28016.2} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG08124 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MGSINTIFHRIHRFVNGGNNVRFVPNTTPAPETLTLNPRAMPSIVSDRRFLLKACKFMDQ
VVKSCHSPRLNLKNSPPFILDILPDTYTHLMLIFTHNNDILQDNEYLRLFLESLINKCKE
IIKLFKTSGIYNDQSDERRKLTKMSLTFSHMLFEIKALFPEGQYIEDRFRMTKKEADCFW
SQHFLKKNIVPWPAFLIALEKHHGAVLGKMEAAELKSTIDLSGDDFISNFEFDVFTRLFY
PFKTLIKNWQTLTSAHPGYCAFLTYDEVKKRLEKLTRKPGSYIFRLSCTRPGQWAIGYVA
PDGKIYQTIPQNKSLIQALHEGHKEGFYIYPNGREQDINLSKLMDVPQADRVQVTSEQYE
LYCEMGTTFELCKICDDNEKNIKIERADICYAQNDSDGGGNTCPFCRYEIKGTNRVIIDR
FKPTSAEIAKVAERKLIAIAPDIPPRTYVSQTQSLPHESHSIPSVDELPLVPPPLPAKTL
AVKEMMNTSQSSASYVNVRELENVATSSDGELSRQRAPSVLAPPLPPRLSILEPPRHEYT
NTSNLA
Download sequence
Identical sequences A8X5V5
6238.CBG08124 CBG08124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]