SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8X5Y3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8X5Y3
Domain Number 1 Region: 10-43,102-165
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000109
Family Voltage-gated potassium channels 0.007
Further Details:      
 
Domain Number 2 Region: 159-239
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000249
Family Voltage-gated potassium channels 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8X5Y3
Sequence length 293
Comment (tr|A8X5Y3|A8X5Y3_CAEBR) Protein CBG08159 {ECO:0000313|EMBL:CAP28044.2} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG08159 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MRASELSPKFQYAFRRCLFYTFVLVAWLFMGMILFPALCTPTVKQDDNEAGVFRLDAKRS
DLLNVLWAETITNGEDDWSALADQKLELYEKALLQHYGIDLDKSDKSFASGLQKSFAIST
TIGPLDVDDFTTVGKFIAVIYALIGTPLFLTVIGQLGKMVTSLWQGTTLWVVTIVYIFIS
AMIYDIVEGGSDDVPFIEAIFSIFLQFTTVGEVDNEFHGVLPYGIVVLGLALITALYQEM
QQNIEHFIHPFEYSFNRLCGTVERWVGERDEAKKSIAETRIEEENEDELSDYE
Download sequence
Identical sequences A8X5Y3
CBG08159 6238.CBG08159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]