SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8X982 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8X982
Domain Number 1 Region: 10-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-28
Family Nuclear receptor 0.00049
Further Details:      
 
Domain Number 2 Region: 427-560
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.67e-23
Family Nuclear receptor ligand-binding domain 0.0012
Further Details:      
 
Domain Number 3 Region: 197-267
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.000000000673
Family Nuclear receptor ligand-binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8X982
Sequence length 585
Comment (tr|A8X982|A8X982_CAEBR) Protein CBR-NHR-47 {ECO:0000313|EMBL:CAP29194.2} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG09380 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSEKLPPGTLCAVCDDVATGKHYSVASCNGCKTFFRRAIVNRREFVCQGNKDCDVNKGVR
CACRACRLQKCLAVGMDTNSIQRDRDRIGYTKRKRKHDDDDKEETHHFENLHMRDGSSGS
PQMNDDSPENCDMKDIKIDFNCLDPIAERLTTLENNFTLLLSRCADLHSYATLEDALNAP
SRFMQPISCEWSDSVVLTHRDDKMPFWRQRLIALYIDWAKTFSTFRSLPYTDKVAMVTNH
ASSFMIMCEAFRTPEHVKSDVVRKRPDLPGLVHNNSGGCTRVQSAETNGEESHDDLTNML
LSQCIQQSINNGIMFDKSAEEKVKMPVPIRQGNEFIQIKQEIMDVPTTDGMIQLPTEYGI
LPADYGTWIPQDYGHPTAGHEGKSDMHNFFEAREFCPPGRPSSCNLNERAMKTISMVEPR
LFPSISSSSSSLSGITPVLTMMIDLVMKPFRQLNFSTTEFALLQAIMFFDPDTEGLDSAS
QRNVIAEQKKLLAVLFRHLQKAYTFDAANERYASIILRMPSIRRAAAKKNESLQVLDMLQ
LHEMNSLVKETSLGPRPSTVQQRMGIGGGAGGCLTFSSETAGEDV
Download sequence
Identical sequences A8X982
CBG09380 6238.CBG09380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]