SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8XC90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8XC90
Domain Number 1 Region: 310-392
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000979
Family I set domains 0.031
Further Details:      
 
Domain Number 2 Region: 91-187
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000328
Family V set domains (antibody variable domain-like) 0.019
Further Details:      
 
Weak hits

Sequence:  A8XC90
Domain Number - Region: 462-505
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0104
Family Fibronectin type III 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8XC90
Sequence length 531
Comment (tr|A8XC90|A8XC90_CAEBR) Protein CBR-RIG-3 {ECO:0000313|EMBL:CAP30188.2} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG10909 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MGRLLGKMLFPLAMCFLLTSAVVASVRYINEILSKNLRKHLFPFPEILPSSTSSSIPFLR
KKNFSKVFDKPTSNEENPIVISSESMDYDTNTITVREGKKMMVSCVFESDETIHKSDLLW
KQPNGNNIDGETNPSLFAIVLNERGSKHRKTSLHFSSVHTRDTGLYTCSGRTAGGETFEK
TVKLVVLPSIEWNDKDTVKGALLGEPITVDCGVKSKSGADPMIQMTNGNGEPLDEEIWTI
AGNEATIDSLKKEHAELAVSCITIEMHQEGNNEEFPVVDRKDVNVEVYTLPEFASDESVQ
YTVIDSHVRDAVVYCNVTHSFPPVRHYTFYHGDEEIKLNDKFNIFVNVGLIQGAHLKIHN
VNENDLGTYKCEANNIKAKSIHTVHLREANAPAEPKVTLVEAKRHSIIWRVDSIDQEPDL
PVNAVEIRHLRAATAEALGVADEDISDSYWKSHSIFMQRNIKSDGIYEINGLRHGHEYVW
RFRQINEAGFGDSVVLRAKTLDDNYLEMTDSATYTTIPLTIATLLVIRLFV
Download sequence
Identical sequences A8XC90
CBG10909 6238.CBG10909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]