SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8XFA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8XFA0
Domain Number 1 Region: 396-580
Classification Level Classification E-value
Superfamily Fibronectin type III 1.09e-26
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 2 Region: 11-44,124-190
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.14e-23
Family Voltage-gated potassium channels 0.0042
Further Details:      
 
Domain Number 3 Region: 232-315
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.03e-18
Family Voltage-gated potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8XFA0
Sequence length 643
Comment (tr|A8XFA0|A8XFA0_CAEBR) Protein CBR-TWK-30 {ECO:0000313|EMBL:CAP31361.2} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG12373 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSCFQVESNKMAKFLSLHVLLIGSVILYIILGAIVFQMLEGEHLDALKKDHMDRIDQNAK
DYVNRLWDLAKENKNNYGTVDDLIKFVKSETVDDFNNYVDTVFYAHRAVRHGYDEVDPDI
VIFDSPTWDFANSVFFTTTMLTSIGYGYVAPSTFGGRLFGVIYCLIGIPLTLVTVANVAK
FLSETIFFLHYELWNKCLEWKRKRKGEVEADPAQPMFGDDENEEEILDRVRLVRFPPLTV
FMFVFVYGCIAAWVVRYWETWTYVESLYFIFISILTVGFGDIRPSPGNIWVTLAFVVVGV
ILTTMCMDVVGRMYLKEIHYLGRKLKSNNPFYLLREAKARRRRAAMASLLAQLAKGMIFA
HKDYNELARKKSKRKKEKRRGSHVLPNEKFMFARLPPDPPSDCQVVSTSAYSVRLAWAPP
FSPDPDLTYNIRYRLKHNEDAKVRELRGIKGNTVEIMSVDSCSLYEFRITAHNKFGESKA
VYLVQYTEPQLSPQHILATRLNANTIELTWEPPYKKSHEVKNYVVYFTENPNASLSEWEK
IPVNGRRVVFPDLRFDWFYMFSATAVFKDGQRSPLSRALFIKTDKIEFHKHLALSRNGLK
SKHYKLPHNFETYAESGIYFWRVCFTCKHKMCRRKSILRLRNM
Download sequence
Identical sequences A8XFA0
6238.CBG12373 CBG12373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]