SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8XJD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8XJD2
Domain Number 1 Region: 17-48,97-172
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.5e-19
Family Voltage-gated potassium channels 0.0057
Further Details:      
 
Domain Number 2 Region: 170-267
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000183
Family Voltage-gated potassium channels 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8XJD2
Sequence length 565
Comment (tr|A8XJD2|A8XJD2_CAEBR) Protein CBR-TWK-16 {ECO:0000313|EMBL:CAP32757.2} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG14128 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MHNLQSKKQAFEVEHAKPFTLHCSLLMLVLLYSFLGGFVFDRIETDAHAEMKRNERTNRT
SCVSQILHSVHRWSRNYTHQEQLAEQIADCFEPEKDERSEWNFVTATLYGFGIVTTLGYN
RIAPITYTGRMFCIVYGICGIPVTMIIIANVGQYLNNFAGDSRRKIEAYRQQRRMSKASL
AGKVYKESSIQVTSLALLCVFLAYVGVGALLLPLLNGELDFFNGLYFNFLCLTAIDFGQL
VPIRVELLPITFLYVCIGLAITTIAISKRKFFKGDFLFFILDIGSEYMKKLHYWGKKMKN
AAQTRIWFGGKTLKVRDLLHAVGKKCGVEPGMIDALDLENVVERTIAIQEGREPPEDLND
EPREPSPRSIIHSPCSTRPSNPPMSPPSPREDHPFIFKMDTPAPRSPLPLPSYELDIKKP
IFQALSNEFMNQSAQEKLFDDLDTFHVELNTELVEDNKCESVIIIEPPATFEDMTVQSSL
NVEDYEKEEKAPKRFREKKEMYGRDPRKLYETYQEEWDRLERLSDRKHGPRRKSVLNLAT
CSPERSVSPSPIRHSLTGEDNRRNS
Download sequence
Identical sequences A8XJD2
6238.CBG14128 CBG14128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]