SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8XQR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8XQR6
Domain Number 1 Region: 524-632
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-24
Family Voltage-gated potassium channels 0.0031
Further Details:      
 
Domain Number 2 Region: 196-228,434-487
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.67e-17
Family Voltage-gated potassium channels 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8XQR6
Sequence length 944
Comment (tr|A8XQR6|A8XQR6_CAEBR) Protein CBR-TWK-44 {ECO:0000313|EMBL:CAP34991.2} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG17283 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MQNCDYCVKVLQCVYGQLRKSVRSKRLLGSKLTHTCKRYPEKRLLCLFDKCCLIYKKFQY
KRSCLKFSKAHLLTIYNDMQPEKYDPRRICTEVQRVSDITSGKKKQVTFSVPDGNAPAPP
IILVEDSEMNGPASQLLNNYPIVRRDTIVDENAMQHLLLHESIWSHAFKKKRKRASSKNR
PSKLKRFVSLLQIIYDKSRVHYIVPIVLLIAYSVLGGLIFWSIERPNEEIMLADKRNYIA
ALTDDLVEVLLQIHNRLIDFNRAYANNTYLLMLHYRGYRKFALNQIHKSVYWYTLSTFYL
TEHEMHKVVALRPKNPEQLWKRHFESNFGRIRALKNYTEQLCLRCWELGVEGANLGWTRY
NYSLMVNQSVEEYNNSVGLGHVLTPVWTFWNAMFLAEHKVCCIMLSIQRIFGLQTFPRNI
FKLKFQIFRHFLKTAGPFFSVTTYTTIGYGNITAKTKLGKLAAMVYAVIGIPLVLMILHK
SGRLFLMGLEHVWDFILRLVALNFSLIDFNVSRITDSFCVGSGTKRVRNTSEDRISEMPL
ILAIGVAFGWMFLCAAIFLRFEKDWDYFKSFYFFFCSLTTIGYGDVTPTNSEDMFIIFGL
IIIGLSLVSMCINVIQLKLEKLFEELLLTLMEELNADPDGTHLKAGTIGAREMWRAWKKR
RGKLGDGLEKAKGARQAANKASENFVKKIFQMLPFSRKRERQHLIAELQKKLQRKEKSTQ
TDFGYPHCEEAYTETSDVDSCVTDFRNSVISDKCKMIDEVVGKLRLFSAHHHLLLIPDGP
ICGPSRCESRPVVALAEASLCSSSSVNPSSYPSSHRPSSTIPSSSPGSRASAPSAASSAK
SAPAASPSRQPPFVDFDPSRRWTFVATNRNQRGYPRGLVVPYMYTRPMSSVVHTTEVRRL
IAELDVRLQDCRSLATPTNSIRGTVSERSFSRSVISDSSIPEEL
Download sequence
Identical sequences A8XQR6
6238.CBG17283 CBG17283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]