SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8XRB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8XRB3
Domain Number 1 Region: 179-291
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-19
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 2 Region: 12-44,100-171
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.94e-19
Family Voltage-gated potassium channels 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8XRB3
Sequence length 572
Comment (tr|A8XRB3|A8XRB3_CAEBR) Protein CBG17601 {ECO:0000313|EMBL:CAP35211.2} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG17601 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MTLFQFLRWFCQLIHLGSYYKFLILMMYTLFGAWMFKTLETTPLTEGIGKTPALIIKEPQ
DAFIFLKKFQETAAKMPDELLLQFVKNQSDILFAAYKAQEEIDWTWCLGILYSVETYTTI
GYGYPVVRTWQARLATIIYAMIGVPFFLVYLASVGKTMSKTMARIDKRMRRTNFGKLLLY
SRVPMANSEASEDPFSIRIAVMMLIIWICFTSAFFSVLEGWTYATSAYFFIVTISTIGYG
DLIFQNQNMIPFNLSLILNGMCLISMCFELTIKRIAKWKQNQFEKHMKKIQKMALLVYEK
DLLVEDASHLDICINPNLMEYAATHTGEETIGFFGEMKEWAYGILVDHVIQSKLETNPNY
ADEELDEEEGQEMVNMVVGSNERGTRKNTGILSSYSCTSKRMIRQTYHTLIDRIKALEQA
KPRKNDMDSIMFIQFLENKKVVKLVELFKHPNQTTTSCQTDISGPVDQKTNQTMNEKIGK
FHFDIRDAVIASSLQAHVSFNLPRLRFQSDQAKMLDEDYVKIPVHMLRRRTLQPPMSPLS
NQASSLKALVVQEQHEKDNSENQSKQRRRTSC
Download sequence
Identical sequences A8XRB3
CBG17601 6238.CBG17601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]