SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8XS25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8XS25
Domain Number 1 Region: 38-166
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.71e-18
Family Nuclear receptor ligand-binding domain 0.016
Further Details:      
 
Domain Number 2 Region: 3-41
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000346
Family Nuclear receptor 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8XS25
Sequence length 170
Comment (tr|A8XS25|A8XS25_CAEBR) Protein CBG17903 {ECO:0000313|EMBL:CAP35444.1} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG17903 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSSCEVCGQAGHGMHFGVNTCRACAAFFRRAAESKWDRMKCLSRFFLDGMRGLDLLHLID
EIQSLDLTETELTFMLAHLCFQYVASRYGGKMSEVMEQFLGELSNDLHEYYTKDRMMIRY
SGRLMKLLRINKEILENIRLYRGRAEVAKVFDVFHLDFSHPEMFRDTGLM
Download sequence
Identical sequences A8XS25
CBG17903 XP_002647713.1.8413 6238.CBG17903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]