SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8XUV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8XUV4
Domain Number 1 Region: 324-412
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.16e-23
Family Voltage-gated potassium channels 0.0019
Further Details:      
 
Domain Number 2 Region: 73-101,163-228
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-17
Family Voltage-gated potassium channels 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8XUV4
Sequence length 1845
Comment (tr|A8XUV4|A8XUV4_CAEBR) Protein CBR-TWK-11 {ECO:0000313|EMBL:CAP36424.2} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG19123 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSNDNFAIEIDPPDDVEYDIEAGFNSSTCHLMHNFEEERPTSLVASIRESAISSKRKVKY
YCSFFCSPIKKLLSTFKLLIIIGLYSFIGAHLFMYLEVPTDLEAKEDGFHQRKIAREVMV
LKMQRILIIFSLRAIYYDNRDDREERWKHAILKFEEDMGLEEPVVETDWTFWMSFLYAGT
IFTTIGYGNIACKTRAGQIATMVYAFVGIPIMLVMLTSLNNFLLKWIKIITNGLSDILLY
LGVRLGITVIRQDEVQKRLRYTKFAKKMKEWKLSSHGAPSSIAVSFKKTENIEKLNFQIS
SSEENRLNSTPEDDEEEEMELDPPVLSTLFATVAWIMLSAAVFCLFEDWTFFTSFYFCFI
SLTTIGLGDVTPANPEYMIATFGVVIVGLSMLTVCIDVIKEKLAQMYMALLQKLLQEYME
AVKSGDPNAASAMMAGFQGRAKFLMPLISKNEGAKVMDKFKQDCTKKGIDPPPVLTNINP
ETGMPAFANAPREDFRDYIDVAQEMFAEEQQRLTQTPLSKSTDFFQSPTPRPTVTVAVTQ
TSAPPPTKSLEVQAGTTMGKFHDYGSQTQTESSDEGIQTDYSVDFDDEMNKEPKKVMADA
GTQYEIVLLTSIGIQPEVSSIYIGAEQSDHSDEESAFESEDEDDFSEYSSCDDESELKSS
AKYKETSLPFEVEHPGMMSLGLQSPPIEITPFSDDESALSEARSSPASTSSKPMKLSPPK
FSKSASIDSTETVIHVKPEEKEKKEEERKEESTHEKKKRRKKRKRMKTKKSREHELRFLK
NSGNQTSPVLMDCSTQYEVFTTDSGSQYDVKGRSRKCQTKLSSINHEQLQGIRETVQKLK
RRESEMSRASNVSESDWDSEAGRESEVAEISLDLSVVALGVDETGRVVEVPKPSKPQESL
SPTSLRTTSESTSAEKVHIDSEDEEIESLDELELYTTDAGMQTEPKMMVDQQDFATPKSL
DIIKNCSTQTTFSTFHLPQKVYESASTSSDEEDVKSESDKDKKSENEVFFMTNAGVQTMH
TSFHLEDKPKIVEEEKLQKEEKTDMEEMPLFLKNSECQTFELEMLTCSTSTEDVRFVGDA
ETSDGYCQTALETKNFEVQTVVKDYLETTMQTEDPSLVTDACQTESIEGTTVHSQTDAPN
TRSFICQTESAVEPEVPPVPSVESVPVECQTDTLDLEEIEVQTEIETSVTESQTENAIVD
DVEMQTELTETITSESQTEKVTVGDLEMQTDQTENTTSESQTEGMVVGDVEMQTEQVETI
ASESQTEQHSVGDIEMQTDEKDTLASTSQTEQLSIEFQETQTDEVTFSREVPLVDQITQS
ETAEFHDSETQYTLSIEDRDVQVTPISFETQTQHSIEIEVKSCQTEGVRMKNKKSQVEDD
STLSILKIDNESQIEVDTSSINLSPVRLDVSHSFTMTEPGALEEKEVQVDEDCFEREETS
QRFFAGPLWSDFDYTPEFGEEGDDEEVVDGETQTHDGSEPKELEEDEEEEEEEEEEVEEE
YYEEVEVDDDGNEIEGGIVKKEGVEEIEDDIEKKAKAEADGADASLKSAEDPSSKATKKF
KKVIKKRIVKRLKSKSEAQLASAQRSTDSLADSVADEFAVQCSPESSEIKIQTVKFKKKK
KTLKTTEPKVEMSTSTVQATIEMCEQSAGDVEDDWLQVNVNAGITTSTSLLQKLYTLFYT
LLSAQLSHVYVQELDEERRMRMSDIGIQTGVLARVQHIYTRPISDDAGSSSSTAPITLRK
SSDSDVEHVPMRTAKSSEESLAPSASGTAISAAESMDDRLWPERASPFASRHSSLKRRKK
EERKTSDKTNIVQDLRARFESKSPAPKSPPKEEGEGSSSDPKQFF
Download sequence
Identical sequences A8XUV4
6238.CBG19123 CBG19123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]