SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8Y3U3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8Y3U3
Domain Number 1 Region: 49-77,124-196
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-20
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Domain Number 2 Region: 236-340
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-16
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8Y3U3
Sequence length 438
Comment (tr|A8Y3U3|A8Y3U3_CAEBR) Protein CBR-TWK-14 {ECO:0000313|EMBL:CAP39562.1} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG23471 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MAITETVMHKLQFARGIGQREMLRANTLPSITRAKVGCFARLRIYEENARFVLICLILIV
YLAFGAALFHWLEWDNEVDERETIEKRMNEYRENYCTRRPMNECDFDEMVRFIADGATSG
LLNTRPRFDILGSLFFSATVISTIGFGTSTPRTQLGRFITIVYGVVGCTCCVLFFNLFLE
RLVTGMSYILRSLRERKIRYRLKEPGNKPVTLLINNEDFNESSSSCEGHMDNWRPSVYKV
FFILFSMCLVLITASAGVYSVIEDWVYIDSLYFCFISFATIGFGDYVSNQQDVTRMSPDL
YRFVNFCILTLGACFFYCLSNVSSIVVRQLLNWMIKKMDIKVEDRSFLCFKKKRRYMGLG
LRPPKGYDMTSERSSVDYADGLLSLKEFLMNNQSSMIMLQKQLIKSAMKNVVENEEQKIS
ATRVGPMGILDEAFGDEP
Download sequence
Identical sequences A8Y3U3
6238.CBG23471 CBG23471 XP_002636746.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]