SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8Y4R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8Y4R2
Domain Number 1 Region: 332-634
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 4.86e-47
Family beta-Lactamase/D-ala carboxypeptidase 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8Y4R2
Sequence length 659
Comment (tr|A8Y4R2|A8Y4R2_CAEBR) Protein CBR-LACT-8 {ECO:0000313|EMBL:CAP39882.2} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG23085 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MRKIVSIGMFRWMQKKHPSVCGTIISRPAQCFLRRHLVIPTLTNAMVKMLFISPLLFFLL
FFLIPAADSTVQPNVTLLTLGDLWETRGMIRTHLFPTKTSTVYPEFAAIPSNQGDGRMHL
TRSALNKAIENVAEMNGVLIHSICSYRHLNVTFYTLNTMFGIGRSEVLIDANMTEMEHKM
SEMTDRRIKVNFICVGANNDTYSAVWHHSPDFVWHFIVDSGPIREIIEKDRLQMTRGYYA
DCFQTYRNDNISRAIIIWRKGFGKKYRIQYGTEVHEMLTDMQRTDLEPVQFASLPRLGQK
RPFPRWILWHGDEFTWGNRTIPRDLSKMNHNWEALNSVIEHRMRSYDIPSISIHILRDNK
MEYSASYGFADILQSIPVKTTHRYRIASVSKLITAMTIGELLADYKHIDLLTPVFGPAGV
LSDVCSPCHPFLLHVRIIHLLEHSSGAWPHTSKFEFDRMEQNQTEFLMRVVQKEFPILFP
GGRHMYSNIGYILLGRIIEKVSGRSYEEYALEKVLNPLGVNATIGKEGDPFEEVTYYSHD
NANAYTSWSTRRLNSAAGWAMKAEDVTKVFHHLEEHKLRRFRWIITPSAVRWNYGRGVQL
GNDGSLYHIGSLAGTEAIGYTWQNVQVAILTNIRGKEQNEQTGWMEKLCKSIADGRFTR
Download sequence
Identical sequences A8Y4R2
6238.CBG23085 CBG23085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]