SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8ZLC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8ZLC4
Domain Number 1 Region: 22-145,201-371
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.16e-42
Family Filamentous hemagglutinin FhaB, secretion domain 0.0084
Further Details:      
 
Domain Number 2 Region: 388-511,543-573
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000691
Family Filamentous hemagglutinin FhaB, secretion domain 0.088
Further Details:      
 
Domain Number 3 Region: 493-670
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000722
Family Filamentous hemagglutinin FhaB, secretion domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8ZLC4
Sequence length 833
Comment (tr|A8ZLC4|A8ZLC4_ACAM1) Haemagglutination activity domain protein {ECO:0000313|EMBL:ABW31951.1} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_B0232 OC=Acaryochloris.
Sequence
MNKSVLLISVLSIWSLLFKSGLAQVTSDQTLLRENSVVELQNNRILIKGGASRGSTLFHS
LKELSVGTGQEVYFNNPSNINLILTRVTGGNRSNIFGTLGVLGDADLFLMNPSGIFFGPH
SKLDLNGSFIGTTASSLIFDQDIEFSAENPQNLPNLTIGVPLGLQFNSRSADIIAKGPRF
QLTSTNPFVTFSGRTGSQEFDLTVKPNKTLALLGTNLDLRGSILTAPGGSIQLGGVKSGY
VGISPSPLGWTFDYQNVQRFGDIHLSELALVDGTGMEGGPTGFIQVQGGQVSITDGSVIR
IGNLGNQTGRRLVIKAADSIKLIGTNLTTGTSSGLITTSLETGSGSDIYLSTPHLILKEG
GLISANTLGFGSGGTLVINATEFIDVIGTSFDPNLLSFISTSTFGVGNAGDIIITTKHLR
VKDGGLVTSATLAAGQGGNIKVSASDGIVLVGANNALSSSSLASGNAGDLFIQTKRLLIK
DGARVDAATFAGGNAGDVIITAVDEIIVSGVDQGSQDPSLISSSTIQLSPELQSGFQVSP
IPTGEAGSVSIQTKALRVSDGAEITVRNDEIGNAGTLHINADQILLKNQGNISATSSAGK
GGDIDLQIRNYLLMRNNSLITAEGRGINDGGNIKITASKIVAIPSENSDIFASSSVGKGG
QIIITAKELFGFRASGQLTNFSDIVSFSQNEPQINGFVAILFPDGLKKLPETIVVPKTIT
TKCRPGQTLGNSTFVDIGRGGIPLGPHHLQTPPSVWQDLRQPQLLKQKSPSSKLPVKPGS
SGVENNNLSSNSASPPTIVEAQGWIRDKKGNIFLSANASELIAYNSGQPVATC
Download sequence
Identical sequences A8ZLC4
gi|158340095|ref|YP_001521265.1| gi|158340095|ref|YP_001521265.1|NC_009927 WP_012167100.1.67183 329726.AM1_B0232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]