SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9A427 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9A427
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-35
Family GHMP Kinase, N-terminal domain 0.00035
Further Details:      
 
Domain Number 2 Region: 171-310
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.64e-30
Family Mevalonate kinase 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9A427
Sequence length 313
Comment (tr|A9A427|A9A427_NITMS) Mevalonate kinase {ECO:0000256|HAMAP-Rule:MF_00217} KW=Complete proteome; Reference proteome OX=436308 OS=Nitrosopumilus maritimus (strain SCM1). GN=Nmar_0315 OC=Nitrosopumilus.
Sequence
MKSKASAPGKVILFGEHFVVYGVKAILCAINKRIAVTAEKIDERKISIKSNIGHLELEPN
KPISEINSPLKPFYYLANKIIQDKNFGIKIDVESEIPLGVGLGSSSACCVAGAAAISNLF
ENNSKEEILKLAIEAEKTIFQNTSGADCTVCTFGGLMEYDKENGFSKIESEPNFHLVIAN
SNVEHSTESVVAGVRKFKKNNEAEFSKLCKDESHLIENVLELLKENNIRELGERVIKNQE
YLERIGISNAKLREMIQTGQNSSFGAKITGAGGGGCIFALTDESNLENTIKEFKEKNHEC
FSVKIDFKGLDTF
Download sequence
Identical sequences A9A427
gi|161527823|ref|YP_001581649.1| 436308.Nmar_0315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]