SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9A532 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9A532
Domain Number 1 Region: 4-161
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.05e-34
Family GHMP Kinase, N-terminal domain 0.0000164
Further Details:      
 
Domain Number 2 Region: 164-284
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.95e-24
Family Homoserine kinase 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9A532
Sequence length 307
Comment (tr|A9A532|A9A532_NITMS) Homoserine kinase {ECO:0000256|HAMAP-Rule:MF_00384} KW=Complete proteome; Reference proteome OX=436308 OS=Nitrosopumilus maritimus (strain SCM1). GN=Nmar_0041 OC=Nitrosopumilus.
Sequence
MASKVTVKAPSSTANLGPGFDVFGLAVDAFYDEVTLTKTKSRITIVTDDNIPTKPDNNTA
GLVVKNMKKKFKIKSGVEIKIKKGVPAGFGMGSSAASAAATAVAFDKLFGLKLDGNSLVE
FAGSGEKASAGSVHYDNVAASVLGGFVIVKTNPLQVTRVDPPTNLRMCVAVPKLEVPKKK
TKVSRGVIPKKVKLTDSILNLSNASAIVAGFMKKDPELIGNSIKDVIVEPARKHMIPGFD
KVKENALKAGALGVTISGAGPSVIAFSKSSADLKKISSAMSRGFASAKTECQTVICKPSK
GAADKRR
Download sequence
Identical sequences A9A532
436308.Nmar_0041 gi|161527553|ref|YP_001581379.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]