SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9A5I1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A9A5I1
Domain Number - Region: 8-47
Classification Level Classification E-value
Superfamily RING/U-box 0.00152
Family RING finger domain, C3HC4 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9A5I1
Sequence length 59
Comment (tr|A9A5I1|A9A5I1_NITMS) Ribosomal protein S14 {ECO:0000313|EMBL:ABX12692.1} KW=Complete proteome; Reference proteome OX=436308 OS=Nitrosopumilus maritimus (strain SCM1). GN=Nmar_0796 OC=Nitrosopumilus.
Sequence
MAKDRSYEFTGRKKHDFGRGSRWCKRCGDYTAVIQKYDLMICRRCFREVATSLGFRKNR
Download sequence
Identical sequences A0A2H9MR95 A9A5I1
436308.Nmar_0796 gi|161528304|ref|YP_001582130.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]