SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9CB49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9CB49
Domain Number 1 Region: 27-189,216-340
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.25e-56
Family FCH domain 0.0049
Further Details:      
 
Domain Number 2 Region: 504-695
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.24e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 
Domain Number 3 Region: 748-808
Classification Level Classification E-value
Superfamily SH3-domain 9.19e-18
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9CB49
Sequence length 946
Comment (tr|A9CB49|A9CB49_PAPAN) Rho GTPase activating protein 4 (Predicted) {ECO:0000313|EMBL:ABX10976.1} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=ARHGAP4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MAAHGKLRRERGLQAEYETQVKEMRWQLSEQLRCLELQGELRRELLQELAEFMRRRAEVE
LEYSRGLEKLAERFSSRGGRLGSSREHQSFRKEPSLLSPLHCWAVLLQHTRQQSRESAAL
SEVLAGPLAQRLSHIAEDVGRLVKKSRDLEQQLQDELLEVVSELQTAKKTYQAYHMESVN
AEAKLREAERQEEKRAGRSVPTTTAAATEAGPLRKSSLKKGGRLVEKRQAKFMEHKLKCT
KARNEYLLSLASVNAAVSNYYLHDVLDLMDCCDTGFHLALGQVLRSYMAAESRTQASQVQ
GLGSLEEAMEALDPSGDKAKVLEVHAAIFCPPLRFDYHPHDGDEVAEICVEMELQDEILP
RAQNIQSRLDRQTIETEEVNKTLKATLQALLEVVASDDGDVLDSFQTSPSTESLKSTSSD
PGSRQAGRRRGQQQETETFYLTKLQEYLSGRSILAKLQAKHEKLQEALQRGDKEEREMSW
TQYTQRKFQKSRHPRPNSQYNQRLFGGDMEKFIQCSGQPVPLVVESCIRFINLNGLQHEG
IFRVSGAQLRVSEIRDAFERGEDPLVEGCTAHDLDSVAGVLKLYFRSLEPPLFPPDLFSE
LLASSELEAMAERVEHVSRLLWRLPAPVLVVLRYLFNFLNHLAQYSDENMMDPYNLAVCF
GPTLLPVPAGQDPVALQGRVNQLVQTLILQPDRVFPPLTSLPGPVYEKCMAPPSASCLGD
AQLESLGADNEPELEAEMLAQEDDLEGVVEAVACFAYTGRTAQELSFRRGDVLRLHERAS
SDWWRGEHNGVRGLIPHKYITLPEGAEKQVVGAGPQTAGESGSSPEGLLASELVHRPEPC
ISPEAVGLSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASATSP
SPGPRSPKAPAGSRLGKNKGFSRGPGAPASPSASHPQGLDTTPKPH
Download sequence
Identical sequences A9CB49
ENSPANP00000002711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]