SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9FAK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9FAK8
Domain Number 1 Region: 260-471
Classification Level Classification E-value
Superfamily ARM repeat 7.58e-17
Family PBS lyase HEAT-like repeat 0.014
Further Details:      
 
Domain Number 2 Region: 26-185
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000275
Family SMI1/KNR4-like 0.015
Further Details:      
 
Weak hits

Sequence:  A9FAK8
Domain Number - Region: 212-254
Classification Level Classification E-value
Superfamily ARM repeat 0.0576
Family HspBP1 domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9FAK8
Sequence length 496
Comment (tr|A9FAK8|A9FAK8_SORC5) Uncharacterized protein {ECO:0000313|EMBL:CAN97914.1} KW=Complete proteome; Reference proteome OX=448385 OS=So ce56)). GN=sce7745 OC=Sorangiineae; Polyangiaceae; Sorangium.
Sequence
MRERLDGIVAKLTAVRERGLSCFGSDAHRFELRPPATEAEVAAFEAARRARLPEDYRAFL
LHVGHGGAGPFYGLLTLAQCDEARYEAIDDLDTACPLHPDTLPPGKDWLDVLLPGEGEAM
DRALRGTLSLGMQGCSYFSQLVVTGPARGRVVYIDLDGGRPYFPENEGFLDWYERWLDEL
LAGYEFHWFGTGMPGFEPELAGALRRGERLAAALAAMCQLPRLGGDTLELVIARLDHPEA
GVRQQALQVLGKFDDGAGARARRFLRDPEPGPRRAALKVVCKGDPARWAADVRALLDDAD
GSIASAALRALDEAKVIMLADLAPRARDPRKGVATDAGWRLAGMASRGVPPSEAAAFVAA
ATAMLDHAEPSVAMYGLQVLVHVDAPALVERLRAFALGEERSHRMSACRALVRQDRAAGF
EVLTELTRHADPFVRQDAARMLGDVGDARVRPALERLLEDETKPFERTATGTRSNVYRVC
DTARMAIEAIDRRALH
Download sequence
Identical sequences A9FAK8
WP_012240353.1.90317 gi|162456027|ref|YP_001618394.1| 448385.sce7745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]