SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9FCH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9FCH3
Domain Number 1 Region: 83-200
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.59e-20
Family Glutathione S-transferase (GST), C-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 22-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000107
Family Glutathione S-transferase (GST), N-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9FCH3
Sequence length 216
Comment (tr|A9FCH3|A9FCH3_SORC5) Gst4 protein {ECO:0000313|EMBL:CAN91663.1} KW=Complete proteome; Reference proteome OX=448385 OS=So ce56)). GN=sce1505 OC=Sorangiineae; Polyangiaceae; Sorangium.
Sequence
MSELIIWTYDWVPEGPRGFVRDLRLRWACEEADLIYVVKTIPFDGRETNHLARQPFGQAP
FLNDGELDIFESGAGLLHLARKSDKLMPPDPAGEAETLQWTIAALNSIEMVTVPWWFLEI
CGDEDNQLAGWMGKRLDQLEKVLSEREWLAAGRFTVADLLMADVLRVPKVRAFGDRPATE
AYVTRVTDRPSFKRAQADQIRLFEAADEKRTEKGAN
Download sequence
Identical sequences A9FCH3
WP_012234140.1.90317 448385.sce1505 gi|162449776|ref|YP_001612143.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]