SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9IQV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9IQV5
Domain Number 1 Region: 44-217
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.37e-37
Family DsbA-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9IQV5
Sequence length 218
Comment (tr|A9IQV5|A9IQV5_BART1) Uncharacterized protein {ECO:0000313|EMBL:CAK01105.1} KW=Complete proteome OX=382640 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506). GN=BT_0671 OC=Bartonellaceae; Bartonella.
Sequence
MIKYRSFLFFGIIFLFITIVQNSVAVALARGIKPVATVDMAELLQSGKVKDRVEGEADAP
VIIVEYASLTCTHCAHFYNDILPQIRKKYIKTGKVKMIFRDYAFDPRATAGFMLARCAPE
DRYFPLIEVLFQKQNEWVWGKDALTPLKKISLMAGFTDESFTACLKNQTILDEVNASFER
GKELGVSATPTFFINGDKYEGAMKVEEFFSLIDSYLKN
Download sequence
Identical sequences A9IQV5
gi|163867896|ref|YP_001609100.1| WP_012231210.1.76171 WP_012231210.1.90605 382640.Btr_0671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]