SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9JRJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9JRJ5
Domain Number 1 Region: 112-518
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.78e-84
Family L-arabinose binding protein-like 0.00079
Further Details:      
 
Weak hits

Sequence:  A9JRJ5
Domain Number - Region: 33-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000115
Family Complement control module/SCR domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9JRJ5
Sequence length 924
Comment (tr|A9JRJ5|A9JRJ5_XENTR) LOC100135080 protein {ECO:0000313|EMBL:AAI55686.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=LOC100135080 OC=Silurana.
Sequence
MCRSITLLFALWLTPVFGSGQSNTTGCRIIHPPRDGGIRYRGLTLTQVKAVEVLPVDYEI
EFVCRGEREISGPKVRKCQRNGTWTDMDKPSRCFRRPDTSIRHPESSRKRALHVGALFPM
SGGWPGGQACQPAAQMALEDVNNRRDILPEYELRLIHHDSQCDPGQATRYLYELLYNDPI
KIMLMPGCSSVSTLVAEAARMWHLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRV
QLFKKWGWTKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAIPVKNLKRQD
ARVIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIPDPAINCTVEEMTQA
VEGHVTTEIVMLNPENTRGISNMTSQEFMEKLKKRLGENPEMTGGLQEAPLAYDAIWALA
LALNKTAYELSKKGRRLEDFNYNNKMISEEIYRAMNSSSFDGVSGHVVFDASGSRMAWTL
IEQLQGGVYKKIGYYDSTKDNLSWYNNDKWIGGSPPADHTKVIITFRYVSQKLFISVSVL
AGLGILLGFVCLSFNIYNSHVRYIQNSQPHLNDVTAAGCILSLAAVFPLGLDGRHIETWH
FPLVCQARLWLLGLGFSLAYGSMFTKIWWIHTAFTKKDDKKERRKQSQTLEPWKLYTTVS
LLLGLDVITLGIWQIVDPLQRSIEEFTKEEPRGDLDVLILPQLEHCSSLKMNTWLGIVYG
SKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDASFA
FSSLAIVFSAYITLVVLFVPKMRRLITRGEWQSEQQDTLKTGSSTNNNEEEKSRLLEREN
QELGRIIAEKEERVMELRQQLRSRRRPSVPARDNCSDNHFPNSSGAVSSLYQPGLPLARC
LVAEGGDKLGRNSCDGSRVHLLYK
Download sequence
Identical sequences A9JRJ5
NP_001107291.1.99540 gi|161611455|gb|AAI55686| gi|166158180|ref|NP_001107291|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]