SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9KMU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9KMU8
Domain Number 1 Region: 316-465
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.41e-27
Family HD domain 0.021
Further Details:      
 
Domain Number 2 Region: 204-300
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.65e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9KMU8
Sequence length 516
Comment (sp|A9KMU8|RNY_LACP7) Ribonuclease Y {ECO:0000255|HAMAP-Rule:MF_00335} KW=Complete proteome; Reference proteome OX=357809 OS=ISDg) (Clostridium phytofermentans). GN=Cphy_2598; OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MLIKIVIACVITAIIVALIAWKSAISYYKKVVEGKIGSADEKAREIIDEALKTAETKKRE
ALLEAKEESLKTKNELERETKERRAELQRYEKRVLTKEETLDRKTEALEKKEAKLVAKEQ
ELDRLRVEVEESHQKQVAELEKISGLTSEQAKEYLIKTVEDEVKHETAVLIKELESRAKE
EAEKKAKDYVVTAIQKCAADHVAETTISVVQLPNDEMKGRIIGREGRNIRTLETLTGVDL
IIDDTPEAVILSGFDPIRRETARIALEKLIVDGRIHPARIEEMVEKAQKEVETMIREEGE
AATLEVGVHGIHPELVRLLGKMKFRTSYGQNALKHSIEVAILSGLLAGEIGVDVRIAKRA
GLLHDIGKSVDHEMEGTHVQIGVDLCRKYKESPIVINAVEAHHGDVEFQSLIACIVQAAD
TISAARPGARRETLETYTNRLKQLEDITNGFKGVDKSFAIQAGREVRVMVVPDQVTDDDM
VLLARDLSKKIESELEYPGMIKVNVIRESRVTDYAK
Download sequence
Identical sequences A9KMU8
357809.Cphy_2598 gi|160880730|ref|YP_001559698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]