SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9P9E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9P9E7
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily SNARE-like 5.04e-31
Family Synatpobrevin N-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 120-187
Classification Level Classification E-value
Superfamily SNARE fusion complex 2.15e-21
Family SNARE fusion complex 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9P9E7
Sequence length 220
Comment (tr|A9P9E7|A9P9E7_POPTR) Vesicle-associated membrane protein 714 {ECO:0000313|EMBL:EEF02869.1} KW=Complete proteome; Reference proteome OX=3694 OS=subsp. trichocarpa). GN=POPTR_0018s01900g OC=Populus.
Sequence
MAILYALVARGSVVLAEFTSTATNASAIARQILDKIPGNDDSNVSYSQDRYIFHVKRTDG
LTVLCMADETAGRRIPFAFLEDIHQRFVRTYGRAVITAQAYAMNDEFSRVLSQQMEYYTN
DPNADRINRLKGEMSQVRNVMIENIDKVLERGDRLELLVDKTANMQGNTFRFRKQARRFR
STVWWRNVKLTVALILLLLVIIYVVLAFVCHGLTLPTCLK
Download sequence
Identical sequences A9P9E7
POPTR_0018s01900.1|PACid:18215315 3694.estExt_Genewise1_v1.C_LG_XVIII1645 XP_002324304.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]