SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9RE77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9RE77
Domain Number 1 Region: 25-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.22e-20
Family Calponin-homology domain, CH-domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9RE77
Sequence length 380
Comment (tr|A9RE77|A9RE77_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ82627.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPA_021318 OC=Physcomitrella.
Sequence
MEASIPPQPTTSSSSRGYSSSASFRESDVEFLQTEAREWLEAVLEEKLDPHTSLQDLLAD
GTILYRISLIVKENLGKLKGNAANRPAAAVPSPDVNRTRTSLKYQPYSYVEAFLKVCKDV
GLLDLDLFNPSDAVDKKDIRHVCVCLLRLSKKARTLNIHLPDFDNPKHTLLSPPPKHLMP
SDVVHNLRDSLQQPSNGPASAKSNIILDLDKEISSSAADLSMGDSESNSVSPEVDSRGLQ
QPRNALQDPENVGDFSGDLSAMEPKDLDEYVRPVNHNGLSEKPQPVVELGIGTLKASQSP
RKSPDALEQYGAKEKGMSRNPKGRYSWFPYAAGVVFVGVLVVMVVARERRRPSLGVYEVQ
PTDSLAEISRRTGNATWQEL
Download sequence
Identical sequences A9RE77
jgi|Phypa1_1|64938|fgenesh1_pg.scaffold_4000053 XP_001752388.1.60028 PP1S4_106V6.1 PP1S4_106V6.2 3218.JGI64938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]