SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9UMI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9UMI2
Domain Number 1 Region: 3-216
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.26e-66
Family Eukaryotic proteases 0.0000663
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9UMI2
Sequence length 219
Comment (tr|A9UMI2|A9UMI2_XENTR) Gzma protein {ECO:0000313|EMBL:AAI57668.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=gzma OC=Silurana.
Sequence
MAYIYSRTGSCGGTLIKQNWVLTAAHCVVNNSEVILGAHNVKSRENEQQRFSVARAIPHP
CFEWKKKIHDIQLLQIKGAAKLNKFVSVLKLPTTDMDVKPGSSCSTAGWGVTKPNGKTPS
DVLREVNVTVVDRGTCNKIYKKFKTEISTNMLCAGAPKKSDKKYDACQGDSGGPLICGKE
FSGIVSFGKKCGDPKYPGIFTRLTARYLQWIRDVTGGAD
Download sequence
Identical sequences A9UMI2
NP_001107158.1.99540 gi|163915656|gb|AAI57668| gi|165973394|ref|NP_001107158| gi|213627368|gb|AAI71196|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]