SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9V809 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9V809
Domain Number 1 Region: 600-666
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000141
Family Calponin-homology domain, CH-domain 0.0075
Further Details:      
 
Domain Number 2 Region: 21-88
Classification Level Classification E-value
Superfamily L domain-like 0.0000374
Family mRNA export factor tap 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9V809
Sequence length 1535
Comment (tr|A9V809|A9V809_MONBE) Predicted protein {ECO:0000313|EMBL:EDQ86398.1} KW=Complete proteome; Reference proteome OX=81824 OS=Monosiga brevicollis (Choanoflagellate). GN=38472 OC=Eukaryota; Choanoflagellida; Craspedida; Salpingoecidae; Monosiga.
Sequence
MSTTARVKEKLAAAGETGVFDLSDAKLHAFPNLSNLDLDELIHYEVLEINLSNNKLVRLP
DLSDFEELEALDCSRNALTDIEKVARITSILTRINFSPPPASSTGDAQEAEQALEMLENG
AKAAEFRAAELRAVQEQERAEQLRQQVEAERRELEARRLAQSELAQAQQADIAEQMRRFE
EQRKELQAERARQQKEAAAQAEAIEQQRRQLEREQERLRQVEAETARRRTEAEKAQQAAS
TARQQAEAEAERQRQVAHREAQEQAARAQAAQEAQAQRERAERERAERERAERERAERER
AERERAERERAERERAEQLAQQKAAREQAVQEQQQQQQQTDRARRALAEQSTGASRDKSR
QRGTPSNIRVENTTSRTLPVPRTGTGGTARTAAGGTTADARSNQARYTPSITAYPSLVQG
ATGSKELPVPRRKNSSQPSVAAASAIGNATAPTSTRPVQEMAASPARSGVQPLSRNIAAT
PKSAPTTTPQRKEPFTPSGPSYTTVSSRELDMLRARRRARLVKLHEQDMKEMRNSPEALN
TVAFDLMEVMHEEDNTIQVGGQGIKSFLLRNRVERAGKNTLRRLARLALQEALLYHFAVE
LINLKRPDSVPKVYMNENDALSGANLKLRKNVDGFLEACRRLQLNTVSDVSSLDILQEKN
TDRVISLGAKMATHPVRNLRAELDGGGLHAHASTDTRGGMPRARVSLTLGRHMFVDDDLE
RLQAEFQQQQVQPAAAVLRAPPQVGGALTARQHAPPQASAQTAPRQLHKNKQHVKETQPE
ATSSLQDHHSEAPIHAMPLGGSILTDVMERQSLRQPSGPRPADSSSPQAALQLKPGFGKD
GTTPKGRKSLFARAFDGSHPQWQPRTHAPAPRTGVRFESQPTSKSDRPDLPVASMASKDP
AQMSAAEREEAMQEVQRLLTPENIAFLKQRAQQRASKSDSAKPAVSSLHTQARPVRPPLK
DSSTKKMHQVPPSPDPSSMSAHQLERVFAGEETVPPTTALEADKMAWLQGDLPAADAAVS
DASITMRQRQAVRVLRRLCAASRRHAEHVVQLDVLHLIKGYAAIRPNKTAESSDSDYMFA
TESLLLVADFARTLLHHPELQAWVKMPTVTTFIQQFVGDFAEHGPSAVFQLQPVDELLAL
WTRLQVTTTSMAQSDDLLDVILRLVTVVSSTSAPMVRNVLNETQQHITTPGARKVLQFLH
DKLLVADDNMNTRLIDYQLTATSESSLVLPLAPEWFFAALRSVQTALDAVQDSLSSSAAE
EVALDTSAILEFYAHIFDVQSALVKGIGIDLWYSELLRAYTLCDPIPSFGSVQKPMSRLL
NFVALHCREVGATVATATELDLQYVQLASSAHDRVLEDILFSGSSDTIHQQFLLLPLAHP
WPSDFRKSLLCHDSIAQVLQTTGSDLMPILHNFQMPLEKDRSIVDLMLRQLFNVQPAQSL
LYWLCLHHVAAFLFRDFGFGMDDLTASLNDDPHAQDHRHHALKRVESLEPAVRRDLLCYA
PSTPIKSLDEVWSNEESVVPATRRELLVQALEMAS
Download sequence
Identical sequences A9V809
XP_001748788.1.20067 81824.JGI38472 jgi|Monbr1|38472|estExt_fgenesh1_pg.C_250117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]