SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9VC52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9VC52
Domain Number 1 Region: 144-212
Classification Level Classification E-value
Superfamily SH3-domain 9.75e-16
Family SH3-domain 0.00049
Further Details:      
 
Domain Number 2 Region: 24-113
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000262
Family BAR domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9VC52
Sequence length 214
Comment (tr|A9VC52|A9VC52_MONBE) Predicted protein {ECO:0000313|EMBL:EDQ84922.1} KW=Complete proteome; Reference proteome OX=81824 OS=Monosiga brevicollis (Choanoflagellate). GN=34505 OC=Eukaryota; Choanoflagellida; Craspedida; Salpingoecidae; Monosiga.
Sequence
MASDRKGILSKAKKQLERQSEKLRQKLGHKDDADDVYADMVANFNRQQANDAYDEARKSF
EFIDRECHEALPSLYDQRIPFYSATLESHCNTTAIFYGACQSALEQLQLFCSHILSPDTS
NEASSTPASANRNAIAAETAAVELPRNALELRVVTHNYEATGDDELNLTRGDQVVVLPFP
DPEDAEDEGWLFGRLGECEGMFPENHTQKIDSAA
Download sequence
Identical sequences A9VC52
81824.JGI34505 XP_001750263.1.20067 jgi|Monbr1|34505|estExt_fgenesh2_pg.C_380076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]