SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9VPS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9VPS8
Domain Number 1 Region: 2-201
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.21e-56
Family Carboxylesterase/thioesterase 1 0.0000000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9VPS8
Sequence length 205
Comment (tr|A9VPS8|A9VPS8_BACWK) Phospholipase/Carboxylesterase {ECO:0000313|EMBL:ABY44504.1} KW=Complete proteome OX=315730 OS=Bacillus weihenstephanensis (strain KBAB4). GN=BcerKBAB4_3329 OC=Bacillus cereus group.
Sequence
MMKHVFQKGKDTSKPVLLLLHGTGGNELDLLPLAERIDREASVLSVRGNVLENGMPRFFR
RLAEGIFDEEDLVFRTKELNEFLNEAAKTYEFDRDNIVAVGYSNGANIAASLLFHYENAL
KGAVLHHPMVPRREIELPNLAEKFVFIAAGTNDPICSPSESEELKMLLENVDVNVTMHWE
NRGHQLTMNEVEKATEWYEKIFSHA
Download sequence
Identical sequences A9VPS8
gi|163941248|ref|YP_001646132.1| 315730.BcerKBAB4_3329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]