SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A9WFA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9WFA0
Domain Number 1 Region: 170-213,252-449,548-665
Classification Level Classification E-value
Superfamily Subtilisin-like 1.2e-66
Family Subtilases 0.0016
Further Details:      
 
Domain Number 2 Region: 459-529
Classification Level Classification E-value
Superfamily PA domain 0.00000112
Family PA domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9WFA0
Sequence length 1115
Comment (tr|A9WFA0|A9WFA0_CHLAA) Peptidase S8 and S53 subtilisin kexin sedolisin {ECO:0000313|EMBL:ABY36084.1} KW=Complete proteome; Reference proteome OX=324602 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl). GN=Caur_2885 OC=Chloroflexaceae; Chloroflexus.
Sequence
MSRLFSRNYLVALTLLLSLVLAGILPLRPVEAQPRPDRPTPGTPLTIEPLTASSREDVAV
NKNLALSRDGTLASVFLKIDSPSLASFMAQNGITDINAPAAQDYLRQLNAELDALIAQAQ
QRIPGLIVTHRFDLIIGGVSVAAPVSHLDQLRRLPNVVEVINDRIERIETYRTPAFIGAT
TAWNRGGGSAFAGEGVIFGVLDSGVWPEHPSFSDPDPLGKPYAPPPPAPGNPGGLRACNF
GSATPGDAPFTCNNKLIGSYRFMSAYDFFVGTQPYEFRSGRDDDGHGTHTASTAAGNRGV
PASDGSRVFGTISGIAPRAYIVNYKVCGELGCFTTDSAAAVQQAIRDGVHVINFSISGGT
NPYSDIASLAFLDAYNAGILVSASAGNSGPAPDTVNHREPWVATVGASTSDRSYLSTLTV
QGSSGTFTAVGASSGAGISTPAPVVVNTTDPLCLNPAAAGTFTGQIVVCERGIIARVAKS
ANVAAGGAIGMILYNPTPSSLDADFHSIPTVHIQNTDGSALLAFLTANPGATATFTPGAP
GPIQGDVMAGFSSRGGPGQTLGISKPDVTAPGVNILAGYTAIEYGQAVPQFAFLSGTSMS
SPHNAGAAILLKWLNPTWTPGQIKSALMTSAKAAGVYKEDGVTRFTPFDAGSGRIDLRKA
WDPGLTFDETGANYLALQNELWKANYPSLYVPRMPGLITVSRTVREVSGYNSFYKSTISY
QAGQPRDFKVIVPKEFFVPANGTYTFNITVDARDVPLGQVRHAVVIFTERNGCQVRFPVT
IVRGEPDIRMEKQCDPATLALRGTTDCTISITNTTFNDVTVTLNDTMPKQLKLVSGSVTG
GATETSNGLTFSGTLTGASPPNISAGRLTFNGYLSLASLGASPNVSLGDETIANFTLSRP
FVFGGQTYNTIGMVSNGYAVIGGGTAADVQYINRTFPNPARPNNTLGAFWTDLDGSAGGG
YYAYLVGFGPCSNPANACWLILEWENAPNWGDGELNTFQIWIGLNGVEDITYSYGPTLSD
GDSGYVTVGAENAFGNRGANIYSNDGFGPIVGTIPTANSNDVYIATTPGTPGQTITIGFR
AQGVRLGRWTNYAELTSPSFFGTYIDPFSGEVVRP
Download sequence
Identical sequences A9WFA0
gi|222526355|ref|YP_002570826.1| 324602.Caur_2885 480224.Chy400_3121 gi|163848429|ref|YP_001636473.1| WP_012258737.1.35445 YP_001636473.1.55443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]