SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9X171 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9X171
Domain Number 1 Region: 149-430
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.42e-79
Family Eukaryotic proteases 0.0000000107
Further Details:      
 
Domain Number 2 Region: 38-101
Classification Level Classification E-value
Superfamily GLA-domain 6.08e-25
Family GLA-domain 0.0000891
Further Details:      
 
Domain Number 3 Region: 90-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000547
Family EGF-type module 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9X171
Sequence length 444
Comment (tr|A9X171|A9X171_PAPAN) Coagulation factor VII (Predicted) {ECO:0000313|EMBL:ABY40834.1} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=F7 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MVSQALGLLCLLLGLQGCLAAVFVTQEEAHGVLHRQRRANSFLEELRPGSLERECKEEQC
SFEEAREIFKDLERTKLFWISYSDGDQCASNPCQNGGSCKDQLQSYICFCLPSFEGRNCE
KNKDDQLICVNENGGCEQYCSDHAGAKRSCWCHEGYSLLADGVSCMPTVEYPCGKIPILE
KRNASKPQGRIVGGRVCPKGECPWQVLLLVNGAQLCGGTLINTIWVISAAHCFDKIKSWR
NLTAVLGEHDLSEHEGDEQSRRVAQVIIPSTYVLGATNHDIALLRLQRPVVLTDHVVPLC
LPERTFSERTLAFVRFSLVSGWGQLLDRGATALELMALNVPRLMTQDCLQQSRKAEASPN
ITEYMFCAGYSDGSRDSCKGDSGGPHATRYRGTWYLTGIVSWGQGCAAVGHFGVYTRVSQ
YIEWLQKLMHSEPRPGVLLRAPFP
Download sequence
Identical sequences A9X171
ENSPANP00000002557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]