SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0BM11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0BM11
Domain Number 1 Region: 42-364
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.26e-128
Family Bee venom hyaluronidase 0.0000112
Further Details:      
 
Weak hits

Sequence:  B0BM11
Domain Number - Region: 430-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0516
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0BM11
Sequence length 478
Comment (tr|B0BM11|B0BM11_XENTR) Hyaluronoglucosaminidase {ECO:0000256|RuleBase:RU610713} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=LOC100144942 OC=Silurana.
Sequence
MPCCLSFLPAFLWLFLGAAANGQLSDSWLNKPTFRPVFTRRPFIIAWNAPTQDCPPRFNV
HLDLKLFDLNASPNEGFVDQNLTIFYKERLGMYPYYDEHLAPVAGGLPQNASLRAHLDKL
PEGIQKYIRSRDKDGLAVIDWEEWRPIWVRNWQNKDVYRQNSRNLVSSRHPTWPREKVDK
EALYEFENAAREFMTETLRHAKNYRPRQLWGFYLFPDCYNHDYVKNRDSYTGQCPDVEIS
RNDQLSWLWEESTALYPSIYLDQILASSENGRKFVRSRVREAMRISYRHHKDYSLPVFVY
TRPTYIRKLDFLSQMDLISTIGESAAQGAAGVIFWGDAEYTKSKETCQMIKKYLDEDLGH
YIVNVTTAAELCSQSLCNGNGRCLRQENNTDAFLHLNPANFQIVSAPKDFQGPSLRAEGK
LSAGDIATLRSQFRCQCYVDWYGDSCGIQRSTNGGAVATGPCGIVLVVSLVALILALL
Download sequence
Identical sequences B0BM11
gi|165970781|gb|AAI58240| gi|187607884|ref|NP_001119986| NP_001119986.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]