SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0BMT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0BMT9
Domain Number 1 Region: 43-142,239-354
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.71e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0BMT9
Sequence length 450
Comment (tr|B0BMT9|B0BMT9_RAT) Sulfide quinone reductase-like (yeast) {ECO:0000313|Ensembl:ENSRNOP00000061547} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_26654 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MAPLVAVVSSPRARLFACFLRLGTQQAGPLQLHTGACCTAKNHYEVLVLGGGSGGITMAT
RMKRRVGAENVAIVEPSERHFYQPIWTLVGAGAKELSSSDRSTLSVIPSGVQWIQDRVAE
LNPDQNCIRTDNGKEISYRYLIIALGIQLDYEKIKGLPEGFAYPKIGSNYSVKTVEKTWK
ALQDFKEGNALFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTALGTIFGVK
KYADALQEIIRERNVSVNYKHNLIEVRADKQEAVFENLDKPGETHVIHYEMLHVTPPMSS
PDVLKRSPVADSAGWVDVDKETLQHKKYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTI
SLIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYTAQPLETFPFDQSKERISMYLMKAD
MMPFLYWNMMLRGYWGGPAFLRKLFHLGLS
Download sequence
Identical sequences B0BMT9
ENSRNOP00000061547 NP_001041378.2.100692 NP_001041378.2.4139 XP_006234949.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]