SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0BN43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0BN43
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 1.46e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000048
Further Details:      
 
Domain Number 2 Region: 242-370
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 5.62e-23
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 430-491
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000209
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0BN43
Sequence length 503
Comment (tr|B0BN43|B0BN43_RAT) Was protein {ECO:0000313|EMBL:AAI58678.1} OX=10116 OS=Rattus norvegicus (Rat). GN=Was OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MSSGPVGGRSGGRGGPAVQQNIPSNLLQDHENQRLFELLGRKCWTLATAVVQLYLALPPG
AEHWTMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYLTPTPFFHTFAGD
DCQVGLNFSDESEAQAFRALVQEKIQKRNQRQSGERRQLPLTPAPTNEERRGGLPPVPPH
PGGDHGGPSGGPLSLGLVTVDIQNPDITSSRYRGLPAPGPGPTDKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPPPPPPCRGGGGSQPLRPPVGSNKGRCGPLPPVPMGGAPPPPTPRVPPP
PGRGGPPPPPPPATGRSGPPPPPLPGAGGPLAPPPPPPPPPPPPVCPGSGPAPPPLPPTP
VSGVGPAPGGGRGALLDQIRQGIQLNKTPGAMENSVPQALPQQSEGLVGALMHVMQKRSK
VIHSSDEGEDQTGEDEEDDEWDD
Download sequence
Identical sequences B0BN43

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]